MYL3 polyclonal antibody View larger

MYL3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MYL3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about MYL3 polyclonal antibody

Brand: Abnova
Reference: PAB30880
Product name: MYL3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human MYL3.
Isotype: IgG
Gene id: 4634
Gene name: MYL3
Gene alias: CMH8|MLC1SB|MLC1V|VLC1
Gene description: myosin, light chain 3, alkali; ventricular, skeletal, slow
Immunogen: Recombinant protein corresponding to human MYL3.
Immunogen sequence/protein sequence: KPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEM
Protein accession: P08590
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30880-48-43-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skeletal muscle with MYL3 polyclonal antibody (Cat # PAB30880) shows strong cytoplasmic positivity in subsets of muscle fibers.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy MYL3 polyclonal antibody now

Add to cart