Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Clonality | Polyclonal |
Host species | Rabbit |
Applications | IHC-P |
Reference: | PAB30876 |
Product name: | IGF1R polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human IGF1R. |
Isotype: | IgG |
Gene id: | 3480 |
Gene name: | IGF1R |
Gene alias: | CD221|IGFIR|JTK13|MGC142170|MGC142172|MGC18216 |
Gene description: | insulin-like growth factor 1 receptor |
Immunogen: | Recombinant protein corresponding to human IGF1R. |
Immunogen sequence/protein sequence: | YIVRWQRQPQDGYLYRHNYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEA |
Protein accession: | P08069 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Shipping condition: | Dry Ice |