Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PDGFRB polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
More info about PDGFRB polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB30872 |
| Product name: | PDGFRB polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human PDGFRB. |
| Isotype: | IgG |
| Gene id: | 5159 |
| Gene name: | PDGFRB |
| Gene alias: | CD140B|JTK12|PDGF-R-beta|PDGFR|PDGFR1 |
| Gene description: | platelet-derived growth factor receptor, beta polypeptide |
| Immunogen: | Recombinant protein corresponding to human PDGFRB. |
| Immunogen sequence/protein sequence: | AQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVAL |
| Protein accession: | P09619 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of U-87 MG with PDGFRB polyclonal antibody (Cat # PAB30872). |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | PDGFRB promotes liver metastasis formation of mesenchymal-like colorectal tumor cells.Steller EJ, Raats DA, Koster J, Rutten B, Govaert KM, Emmink BL, Snoeren N, van Hooff SR, Holstege FC, Maas C, Borel Rinkes IH, Kranenburg O. Neoplasia. 2013 Feb;15(2):204-17. |