SH3KBP1 polyclonal antibody View larger

SH3KBP1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SH3KBP1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about SH3KBP1 polyclonal antibody

Brand: Abnova
Reference: PAB30855
Product name: SH3KBP1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human SH3KBP1.
Isotype: IgG
Gene id: 30011
Gene name: SH3KBP1
Gene alias: CIN85|GIG10|MIG18
Gene description: SH3-domain kinase binding protein 1
Genbank accession: Q96B97
Immunogen: Recombinant protein corresponding to human SH3KBP1.
Immunogen sequence/protein sequence: GDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSHPTTSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVTISQVSDNKASLP
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1000)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: PAB30855-46-multi-1.jpg
Application image note: Western Blot (Cell lysate) analysis of (1) NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) and (2) NBT-II cell lysate (Rat Wistar bladder tumour cells).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy SH3KBP1 polyclonal antibody now

Add to cart