MAD2L1 polyclonal antibody View larger

MAD2L1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAD2L1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about MAD2L1 polyclonal antibody

Brand: Abnova
Reference: PAB30854
Product name: MAD2L1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human MAD2L1.
Isotype: IgG
Gene id: 4085
Gene name: MAD2L1
Gene alias: HSMAD2|MAD2
Gene description: MAD2 mitotic arrest deficient-like 1 (yeast)
Genbank accession: Q13257
Immunogen: Recombinant protein corresponding to human MAD2L1.
Immunogen sequence/protein sequence: NNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIH
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
Western Blot (1:250-500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30854-46-multi-1.jpg
Application image note: Western Blot (Cell lysate) analysis of (1) Human RT-4 cell and (2) Human U-251MG sp cell.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy MAD2L1 polyclonal antibody now

Add to cart