CXADR polyclonal antibody View larger

CXADR polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CXADR polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about CXADR polyclonal antibody

Brand: Abnova
Reference: PAB30853
Product name: CXADR polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human CXADR.
Isotype: IgG
Gene id: 1525
Gene name: CXADR
Gene alias: CAR|HCAR
Gene description: coxsackie virus and adenovirus receptor
Genbank accession: P78310
Immunogen: Recombinant protein corresponding to human CXADR.
Immunogen sequence/protein sequence: ITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKI
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
Western Blot (1:500-1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30853-46-12-1.jpg
Application image note: Western Blot (Cell lysate) analysis of human HepG2 cell.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CXADR polyclonal antibody now

Add to cart