RHOXF2 polyclonal antibody View larger

RHOXF2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RHOXF2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about RHOXF2 polyclonal antibody

Brand: Abnova
Reference: PAB30850
Product name: RHOXF2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human RHOXF2.
Isotype: IgG
Gene id: 84528
Gene name: RHOXF2
Gene alias: PEPP-2|PEPP2|THG1
Gene description: Rhox homeobox family, member 2
Genbank accession: Q9BQY4
Immunogen: Recombinant protein corresponding to human RHOXF2.
Immunogen sequence/protein sequence: DQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQ
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30850-46-89-1.jpg
Application image note: Western Blot (Cell lysate) analysis of (1) Negative control (vector only transfected HEK293T lysate), and (2) Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy RHOXF2 polyclonal antibody now

Add to cart