MAP2 polyclonal antibody View larger

MAP2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAP2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about MAP2 polyclonal antibody

Brand: Abnova
Reference: PAB30796
Product name: MAP2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human MAP2.
Isotype: IgG
Gene id: 4133
Gene name: MAP2
Gene alias: DKFZp686I2148|MAP2A|MAP2B|MAP2C
Gene description: microtubule-associated protein 2
Immunogen: Recombinant protein corresponding to human MAP2.
Immunogen sequence/protein sequence: SLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVK
Protein accession: P11137
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30796-48-51-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with MAP2 polyclonal antibody (Cat # PAB30796) shows strong cytoplasmic and nuclear positivity in neuronal cells.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy MAP2 polyclonal antibody now

Add to cart