MINA polyclonal antibody View larger

MINA polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MINA polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about MINA polyclonal antibody

Brand: Abnova
Reference: PAB30793
Product name: MINA polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human MINA.
Isotype: IgG
Gene id: 84864
Gene name: MINA
Gene alias: DKFZp762O1912|FLJ14393|MDIG|MINA53|NO52
Gene description: MYC induced nuclear antigen
Immunogen: Recombinant protein corresponding to human MINA.
Immunogen sequence/protein sequence: EKLECNFGSLVGSNVYITPAGSQGLPPHYDDVEVFILQLEGEKHWRLYHPTVPLAREYSVEAEERIGRPVHEFMLKPGDLLYFPRGTIHQADTPAGLAHSTHVTISTYQN
Protein accession: Q8IUF8
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30793-49-187-1.jpg
Application image note: Immunofluorescent staining of U-251 MG with MINA polyclonal antibody (Cat # PAB30793) (Green) shows positivity in nucleus.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy MINA polyclonal antibody now

Add to cart