ACAT1 polyclonal antibody View larger

ACAT1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACAT1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about ACAT1 polyclonal antibody

Brand: Abnova
Reference: PAB30781
Product name: ACAT1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human ACAT1.
Isotype: IgG
Gene id: 38
Gene name: ACAT1
Gene alias: ACAT|MAT|T2|THIL
Gene description: acetyl-Coenzyme A acetyltransferase 1
Immunogen: Recombinant protein corresponding to human ACAT1.
Immunogen sequence/protein sequence: NEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMV
Protein accession: P24752
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30781-49-23-1.jpg
Application image note: Immunofluorescent staining of U-2 OS with ACAT1 polyclonal antibody (Cat # PAB30781) (Green) shows positivity in mitochondria.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy ACAT1 polyclonal antibody now

Add to cart