MAP3K10 polyclonal antibody View larger

MAP3K10 polyclonal antibody

PAB30773_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAP3K10 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about MAP3K10 polyclonal antibody

Brand: Abnova
Reference: PAB30773
Product name: MAP3K10 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human MAP3K10.
Isotype: IgG
Gene id: 4294
Gene name: MAP3K10
Gene alias: MLK2|MST
Gene description: mitogen-activated protein kinase kinase kinase 10
Immunogen: Recombinant protein corresponding to human MAP3K10.
Immunogen sequence/protein sequence: LPSGFEHKITVQASPTLDKRKGSDGASPPASPSIIPRLRAIRLTPVDCGGSSSGSSSGGSGTWSRGGPPKKEELVGGKKKGRTWGPSSTLQKERVGGEERLKGLGEGSKQWSSS
Protein accession: Q02779
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30773-49-4-1.jpg
Application image note: Immunofluorescent staining of A-431 cells with MAP3K10 polyclonal antibody (Cat # PAB30773) (Green) shows positivity in actin filaments.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy MAP3K10 polyclonal antibody now

Add to cart