Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Rabbit |
Applications | WB-Ce,IHC-P,IF |
Brand: | Abnova |
Reference: | PAB30767 |
Product name: | ZBTB7B polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human ZBTB7B. |
Isotype: | IgG |
Gene id: | 51043 |
Gene name: | ZBTB7B |
Gene alias: | DKFZp686G01254|THPOK|ZBTB15|ZFP67|ZNF857B|c-Krox|hcKrox |
Gene description: | zinc finger and BTB domain containing 7B |
Immunogen: | Recombinant protein corresponding to human ZBTB7B. |
Immunogen sequence/protein sequence: | AHPLTYEEEEVAGRVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSPEELGSDEDAIDPDLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKII |
Protein accession: | O15156 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | Immunofluorescent staining of A-431 cells with ZBTB7B polyclonal antibody (Cat # PAB30767) (Green) shows positivity in nucleus but excluded from the nucleoli. |
Applications: | WB-Ce,IHC-P,IF |
Shipping condition: | Dry Ice |