USP5 polyclonal antibody View larger

USP5 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of USP5 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,WB-Ce,IHC-P,IF

More info about USP5 polyclonal antibody

Brand: Abnova
Reference: PAB30765
Product name: USP5 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human USP5.
Isotype: IgG
Gene id: 8078
Gene name: USP5
Gene alias: ISOT
Gene description: ubiquitin specific peptidase 5 (isopeptidase T)
Immunogen: Recombinant protein corresponding to human USP5.
Immunogen sequence/protein sequence: YVDKLEKIFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGERVPEQKEVQDGIAPRMFKALIGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVF
Protein accession: P45974
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB30765-49-187-1.jpg
Application image note: Immunofluorescent staining of U-251 MG with USP5 polyclonal antibody (Cat # PAB30765) (Green) shows positivity in cytoplasm and nucleus but excluded from the nucleoli.
Applications: WB,WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy USP5 polyclonal antibody now

Add to cart