UBQLN2 polyclonal antibody View larger

UBQLN2 polyclonal antibody

PAB30759_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBQLN2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about UBQLN2 polyclonal antibody

Brand: Abnova
Reference: PAB30759
Product name: UBQLN2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human UBQLN2.
Isotype: IgG
Gene id: 29978
Gene name: UBQLN2
Gene alias: CHAP1|CHAP1/DSK2|Dsk2|HRIHFB2157|LIC-2|N4BP4|PLIC-2|PLIC2|RIHFB2157
Gene description: ubiquilin 2
Immunogen: Recombinant protein corresponding to human UBQLN2.
Immunogen sequence/protein sequence: LSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSSAAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLN
Protein accession: Q9UHD9
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30759-49-23-1.jpg
Application image note: Immunofluorescent staining of U-2 OS with UBQLN2 polyclonal antibody (Cat # PAB30759) (Green) shows positivity in plasma membrane and cytoplasm.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy UBQLN2 polyclonal antibody now

Add to cart