Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NR5A2 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P,IF |
More info about NR5A2 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB30730 |
| Product name: | NR5A2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human NR5A2. |
| Isotype: | IgG |
| Gene id: | 2494 |
| Gene name: | NR5A2 |
| Gene alias: | B1F|B1F2|CPF|FTF|FTZ-F1|FTZ-F1beta|LRH-1|hB1F|hB1F-2 |
| Gene description: | nuclear receptor subfamily 5, group A, member 2 |
| Immunogen: | Recombinant protein corresponding to human NR5A2. |
| Immunogen sequence/protein sequence: | GGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELL |
| Protein accession: | O00482 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescent staining of A-549 cells with NR5A2 polyclonal antibody (Cat # PAB30730) (Green) shows positivity in nucleus but excluded from the nucleoli. |
| Applications: | IHC-P,IF |
| Shipping condition: | Dry Ice |