Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Rabbit |
Applications | WB-Ce,IHC-P,IF |
Brand: | Abnova |
Reference: | PAB30705 |
Product name: | ILKAP polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human ILKAP. |
Isotype: | IgG |
Gene id: | 80895 |
Gene name: | ILKAP |
Gene alias: | DKFZp434J2031|FLJ10181|MGC4846|PP2C-DELTA |
Gene description: | integrin-linked kinase-associated serine/threonine phosphatase 2C |
Immunogen: | Recombinant protein corresponding to human ILKAP. |
Immunogen sequence/protein sequence: | PLLFDDLPPASSTDSGSGGPLLFDDLPPASSGDSGSLATSISQMVKTEGKGAKRKTSEEEKNGSEELVEKKVCKASSVIFGLKGYVAERKGEREEMQDAHV |
Protein accession: | Q9H0C8 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | Immunofluorescent staining of A-431 cells with ILKAP polyclonal antibody (Cat # PAB30705) (Green) shows positivity in nucleus. |
Applications: | WB-Ce,IHC-P,IF |
Shipping condition: | Dry Ice |