GSTZ1 polyclonal antibody View larger

GSTZ1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GSTZ1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about GSTZ1 polyclonal antibody

Brand: Abnova
Reference: PAB30698
Product name: GSTZ1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human GSTZ1.
Isotype: IgG
Gene id: 2954
Gene name: GSTZ1
Gene alias: GSTZ1-1|MAAI|MAI|MGC2029
Gene description: glutathione transferase zeta 1
Immunogen: Recombinant protein corresponding to human GSTZ1.
Immunogen sequence/protein sequence: NLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
Protein accession: O43708
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30698-49-23-1.jpg
Application image note: Immunofluorescent staining of U-2 OS with GSTZ1 polyclonal antibody (Cat # PAB30698) (Green) shows positivity in cytoplasm.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy GSTZ1 polyclonal antibody now

Add to cart