RBM23 polyclonal antibody View larger

RBM23 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RBM23 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about RBM23 polyclonal antibody

Brand: Abnova
Reference: PAB30676
Product name: RBM23 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human RBM23.
Isotype: IgG
Gene id: 55147
Gene name: RBM23
Gene alias: CAPERbeta|FLJ10482|MGC4458|PP239|RNPC4
Gene description: RNA binding motif protein 23
Immunogen: Recombinant protein corresponding to human RBM23.
Immunogen sequence/protein sequence: MASDDFDIVIEAMLEAPYKKEEDEQQRKEVKKDYPSNTTSSTSNSGNETSGSSTIGETSNRSRDRDRYRRRNSRSRSPGRQCRHRSRSWDRRHGSESRSRDHRREDRVHYRSPPLATGYRYGHSKSPHFREKSP
Protein accession: Q86U06
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30676-49-23-1.jpg
Application image note: Immunofluorescent staining of U-2 OS with RBM23 polyclonal antibody (Cat # PAB30676) (Green) shows positivity in intermediate filaments.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy RBM23 polyclonal antibody now

Add to cart