MARS polyclonal antibody View larger

MARS polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MARS polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about MARS polyclonal antibody

Brand: Abnova
Reference: PAB30671
Product name: MARS polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human MARS.
Isotype: IgG
Gene id: 4141
Gene name: MARS
Gene alias: FLJ35667|METRS|MTRNS
Gene description: methionyl-tRNA synthetase
Immunogen: Recombinant protein corresponding to human MARS.
Immunogen sequence/protein sequence: FVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDKCGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQFITRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFD
Protein accession: P56192
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: PAB30671-49-multi-1.jpg
Application image note: Immunofluorescent staining of U-2 OS (A), mouse cerebellum (B), mouse olfactory bulb (C), mouse visual cortex (D), mouse cerebral peduncle (E) and mouse pons (F) with MARS polyclonal antibody (Cat # PAB30671) (Green). A: U-2 OS shows positivity in cytoplasm. B: Mouse cerebellum shows cytoplasmic immunoreactivity in Purkinje cells. C: Mouse olfactory bulb shows cytoplasmic positivity in mitral and external plexiform layer neurons. D: Mouse visual cortex shows cytoplasmic and axonal staining in neurons. E: Mouse cerebral peduncle shows cytoplasmic positivity in red nucleus neurons. F: Mouse pons shows neuronal positivity in motor trigeminal nucleus.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy MARS polyclonal antibody now

Add to cart