BCAP31 polyclonal antibody View larger

BCAP31 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BCAP31 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about BCAP31 polyclonal antibody

Brand: Abnova
Reference: PAB30653
Product name: BCAP31 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human BCAP31.
Isotype: IgG
Gene id: 10134
Gene name: BCAP31
Gene alias: 6C6-AG|BAP31|CDM|DXS1357E
Gene description: B-cell receptor-associated protein 31
Immunogen: Recombinant protein corresponding to human BCAP31.
Immunogen sequence/protein sequence: ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP
Protein accession: P51572
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB30653-49-23-1.jpg
Application image note: Immunofluorescent staining of U-2 OS with BCAP31 polyclonal antibody (Cat # PAB30653) (Green) shows positivity in endoplasmic reticulum.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy BCAP31 polyclonal antibody now

Add to cart