JPH1 polyclonal antibody View larger

JPH1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of JPH1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about JPH1 polyclonal antibody

Brand: Abnova
Reference: PAB30567
Product name: JPH1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human JPH1.
Isotype: IgG
Gene id: 56704
Gene name: JPH1
Gene alias: DKFZp762L0313|JP-1|JP1
Gene description: junctophilin 1
Immunogen: Recombinant protein corresponding to amino acids 387-512 of human JPH1.
Immunogen sequence/protein sequence: KADAADQAALAARQECDIARAVARELSPDFYQPGPDYVKQRFQEGVDAKENPEEKVPEKPPTPKESPHFYRKGTTPPRSPEASPKHSHSPASSPKPLKKQNPSSGARLNQDKRSVADEQVTAIVNK
Protein accession: Q9HDC5
Form: Liquid
Recommend dilutions: Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30567-49-187-1.jpg
Application image note: Immunofluorescent staining of human cell line U-251 MG with JPH1 polyclonal antibody (Cat # PAB30567) shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy JPH1 polyclonal antibody now

Add to cart