Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CPT1A polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P,IF |
More info about CPT1A polyclonal antibody
| Reference: | PAB30564 |
| Product name: | CPT1A polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human CPT1A. |
| Isotype: | IgG |
| Gene id: | 1374 |
| Gene name: | CPT1A |
| Gene alias: | CPT1|CPT1-L|L-CPT1 |
| Gene description: | carnitine palmitoyltransferase 1A (liver) |
| Immunogen: | Recombinant protein corresponding to amino acids 392-499 of human CPT1A. |
| Immunogen sequence/protein sequence: | ARCRQAYFGRGKNKQSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYA |
| Protein accession: | P50416 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1 - 4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200) Western Blot (1:250 - 1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Shipping condition: | Dry Ice |