Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P,IF |
Brand: | Abnova |
Reference: | PAB30563 |
Product name: | ALPL polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human ALPL. |
Isotype: | IgG |
Gene id: | 249 |
Gene name: | ALPL |
Gene alias: | AP-TNAP|FLJ40094|FLJ93059|HOPS|MGC161443|MGC167935|TNAP|TNSALP |
Gene description: | alkaline phosphatase, liver/bone/kidney |
Immunogen: | Recombinant protein corresponding to amino acids 198-316 of human ALPL. |
Immunogen sequence/protein sequence: | SQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDPHNVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVA |
Protein accession: | P05186 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1 - 4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescent staining of human cell line U-2 OS with ALPL polyclonal antibody (Cat # PAB30563) shows positivity in cytoplasm. Antibody staining is shown in green. |
Applications: | IHC-P,IF |
Shipping condition: | Dry Ice |