NGFRAP1 polyclonal antibody View larger

NGFRAP1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NGFRAP1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about NGFRAP1 polyclonal antibody

Brand: Abnova
Reference: PAB30552
Product name: NGFRAP1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human NGFRAP1.
Isotype: IgG
Gene id: 27018
Gene name: NGFRAP1
Gene alias: BEX3|Bex|DXS6984E|HGR74|NADE
Gene description: nerve growth factor receptor (TNFRSF16) associated protein 1
Immunogen: Recombinant protein corresponding to human NGFRAP1.
Immunogen sequence/protein sequence: NEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEF
Protein accession: Q00994
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30552-48-12-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with NGFRAP1 polyclonal antibody (Cat # PAB30552) shows strong cytoplasmic positivity in cells in seminiferus tubules and leydig cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy NGFRAP1 polyclonal antibody now

Add to cart