IL16 polyclonal antibody View larger

IL16 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL16 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about IL16 polyclonal antibody

Brand: Abnova
Reference: PAB30544
Product name: IL16 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human IL16.
Isotype: IgG
Gene id: 3603
Gene name: IL16
Gene alias: FLJ16806|FLJ42735|FLJ44234|HsT19289|IL-16|LCF|prIL-16
Gene description: interleukin 16 (lymphocyte chemoattractant factor)
Immunogen: Recombinant protein corresponding to human IL16.
Immunogen sequence/protein sequence: QRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAETSALDTGFSLNLSELREYTEGLTEAKEDDDG
Protein accession: Q14005
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30544-48-9-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human spleen with IL16 polyclonal antibody (Cat # PAB30544) shows strong cytoplasmic positivity in cells of white pulp.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy IL16 polyclonal antibody now

Add to cart