CTNND1 polyclonal antibody View larger

CTNND1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CTNND1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about CTNND1 polyclonal antibody

Brand: Abnova
Reference: PAB30541
Product name: CTNND1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human CTNND1.
Isotype: IgG
Gene id: 1500
Gene name: CTNND1
Gene alias: CAS|CTNND|KIAA0384|P120CAS|P120CTN|p120
Gene description: catenin (cadherin-associated protein), delta 1
Immunogen: Recombinant protein corresponding to human CTNND1.
Immunogen sequence/protein sequence: SVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTR
Protein accession: O60716
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB30541-48-37-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human gallbladder with CTNND1 polyclonal antibody (Cat # PAB30541) shows membranous positivity in glandular cells.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy CTNND1 polyclonal antibody now

Add to cart