SRPK2 polyclonal antibody View larger

SRPK2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SRPK2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about SRPK2 polyclonal antibody

Brand: Abnova
Reference: PAB30538
Product name: SRPK2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human SRPK2.
Isotype: IgG
Gene id: 6733
Gene name: SRPK2
Gene alias: FLJ36101|SFRSK2
Gene description: SFRS protein kinase 2
Immunogen: Recombinant protein corresponding to human SRPK2.
Immunogen sequence/protein sequence: QQLDDEDDDEEDCPNPEEYNLDEPNAESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQEESSPSHDRSRTVSASSTGDLPKAKTRAADLLVNPL
Protein accession: P78362
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30538-48-52-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum with SRPK2 polyclonal antibody (Cat # PAB30538) shows strong nuclear positivity in purkinje cells and cells of molecular layer.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy SRPK2 polyclonal antibody now

Add to cart