MAP4K2 polyclonal antibody View larger

MAP4K2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAP4K2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about MAP4K2 polyclonal antibody

Brand: Abnova
Reference: PAB30525
Product name: MAP4K2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human MAP4K2.
Isotype: IgG
Gene id: 5871
Gene name: MAP4K2
Gene alias: BL44|GCK|RAB8IP
Gene description: mitogen-activated protein kinase kinase kinase kinase 2
Immunogen: Recombinant protein corresponding to human MAP4K2.
Immunogen sequence/protein sequence: ETDPLNEPWEEEWTLLGKEELSGSLLQSVQEALEERSLTIRSASEFQELDSPDDTMGTIKRAPFLGPLPTDPPAEEPLSSPPGTLPPPPSGPNSSPLLPTAWATMKQRE
Protein accession: Q12851
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30525-48-10-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with MAP4K2 polyclonal antibody (Cat # PAB30525) shows strong cytoplasmic positivity in germinal center cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy MAP4K2 polyclonal antibody now

Add to cart