KAT5 polyclonal antibody View larger

KAT5 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KAT5 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about KAT5 polyclonal antibody

Brand: Abnova
Reference: PAB30517
Product name: KAT5 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human KAT5.
Isotype: IgG
Gene id: 10524
Gene name: KAT5
Gene alias: ESA1|HTATIP|HTATIP1|PLIP|TIP|TIP60|cPLA2
Gene description: K(lysine) acetyltransferase 5
Immunogen: Recombinant protein corresponding to amino acids 150 - 286 of human KAT5.
Immunogen sequence/protein sequence: KVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLR
Protein accession: Q92993
Form: Liquid
Recommend dilutions: Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30517-48-51-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex using KAT5 polyclonal antibody (Cat # PAB30517) shows strong nuclear positivity in neurons.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy KAT5 polyclonal antibody now

Add to cart