SIK2 polyclonal antibody View larger

SIK2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SIK2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about SIK2 polyclonal antibody

Brand: Abnova
Reference: PAB30514
Product name: SIK2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human SIK2.
Isotype: IgG
Gene id: 23235
Gene name: SIK2
Gene alias: DKFZp434K1115|KIAA0781|LOH11CR1I|QIK|SNF1LK2
Gene description: salt-inducible kinase 2
Immunogen: Recombinant protein corresponding to amino acids 325 - 457 of human SIK2.
Immunogen sequence/protein sequence: HFAAIYFLLVERLKSHRSSFPVEQRLDGRQRRPSTIAEQTVAKAQTVGLPVTMHSPNMRLLRSALLPQASNVEAFSFPASGCQAEAAFMEEECVDTPKVNGCLLDPVPPVLVRKGCQSLPSNMMETSIDEGLE
Protein accession: Q9H0K1
Form: Liquid
Recommend dilutions: Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30514-48-43-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skeletal muscle using SIK2 polyclonal antibody (Cat # PAB30514) shows cytoplasmic positivity in myocytes.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy SIK2 polyclonal antibody now

Add to cart