PDCD1LG2 polyclonal antibody View larger

PDCD1LG2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDCD1LG2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about PDCD1LG2 polyclonal antibody

Brand: Abnova
Reference: PAB30468
Product name: PDCD1LG2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human PDCD1LG2.
Isotype: IgG
Gene id: 80380
Gene name: PDCD1LG2
Gene alias: B7DC|Btdc|CD273|MGC142238|MGC142240|PD-L2|PDCD1L2|PDL2|bA574F11.2
Gene description: programmed cell death 1 ligand 2
Immunogen: Recombinant protein corresponding to human PDCD1LG2.
Immunogen sequence/protein sequence: GYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPT
Protein accession: Q9BQ51
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30468-48-38-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human pancreas with PDCD1LG2 polyclonal antibody (Cat # PAB30468) shows strong cytoplasmic positivity with granular pattern in exocrine glandular cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy PDCD1LG2 polyclonal antibody now

Add to cart