APC polyclonal antibody View larger

APC polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APC polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about APC polyclonal antibody

Brand: Abnova
Reference: PAB30466
Product name: APC polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human APC.
Isotype: IgG
Gene id: 324
Gene name: APC
Gene alias: BTPS2|DP2|DP2.5|DP3|GS
Gene description: adenomatous polyposis coli
Immunogen: Recombinant protein corresponding to human APC.
Immunogen sequence/protein sequence: DNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRNQSTTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKP
Protein accession: P25054
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30466-48-I6-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human duodenum with APC polyclonal antibody (Cat # PAB30466) shows strong cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy APC polyclonal antibody now

Add to cart