POSTN polyclonal antibody View larger

POSTN polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of POSTN polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about POSTN polyclonal antibody

Brand: Abnova
Reference: PAB30452
Product name: POSTN polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human POSTN.
Isotype: IgG
Gene id: 10631
Gene name: POSTN
Gene alias: MGC119510|MGC119511|OSF-2|PDLPOSTN|PN|RP11-412K4.1|periostin
Gene description: periostin, osteoblast specific factor
Immunogen: Recombinant protein corresponding to human POSTN.
Immunogen sequence/protein sequence: GLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEG
Protein accession: Q15063
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30452-48-305-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human bronchus with POSTN polyclonal antibody (Cat # PAB30452) shows strong cytoplasmic positivity in respiratory epithelial cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy POSTN polyclonal antibody now

Add to cart