JMJD7 polyclonal antibody View larger

JMJD7 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of JMJD7 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about JMJD7 polyclonal antibody

Brand: Abnova
Reference: PAB30395
Product name: JMJD7 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human JMJD7.
Isotype: IgG
Gene id: 100137047
Gene name: JMJD7
Gene alias: FLJ20543|FLJ20656|FLJ20807|FLJ77014|FLJ78330
Gene description: jumonji domain containing 7
Immunogen: Recombinant protein corresponding to human JMJD7.
Immunogen sequence/protein sequence: LPLSFVLDVLEGRAQHPGVLYVQKQCSNLPSELPQLLPDLESHVPWASEALGKMPDAVNFWLGEAAAVTSLHKDHYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTE
Protein accession: P0C870
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30395-48-52-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum with JMJD7 polyclonal antibody (Cat # PAB30395) shows strong cytoplasmic positivity in Purkinje cells at 1:20-1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy JMJD7 polyclonal antibody now

Add to cart