FLNB polyclonal antibody View larger

FLNB polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLNB polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about FLNB polyclonal antibody

Brand: Abnova
Reference: PAB30384
Product name: FLNB polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human FLNB.
Isotype: IgG
Gene id: 2317
Gene name: FLNB
Gene alias: ABP-278|AOI|DKFZp686A1668|DKFZp686O033|FH1|FLN1L|LRS1|SCT|TABP|TAP
Gene description: filamin B, beta (actin binding protein 278)
Immunogen: Recombinant protein corresponding to human FLNB.
Immunogen sequence/protein sequence: HGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTV
Protein accession: O75369
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30384-48-7-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with FLNB polyclonal antibody (Cat # PAB30384) shows strong cytoplasmic and membranous positivity in glandular cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy FLNB polyclonal antibody now

Add to cart