Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB30384 |
Product name: | FLNB polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human FLNB. |
Isotype: | IgG |
Gene id: | 2317 |
Gene name: | FLNB |
Gene alias: | ABP-278|AOI|DKFZp686A1668|DKFZp686O033|FH1|FLN1L|LRS1|SCT|TABP|TAP |
Gene description: | filamin B, beta (actin binding protein 278) |
Immunogen: | Recombinant protein corresponding to human FLNB. |
Immunogen sequence/protein sequence: | HGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTV |
Protein accession: | O75369 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with FLNB polyclonal antibody (Cat # PAB30384) shows strong cytoplasmic and membranous positivity in glandular cells at 1:50-1:200 dilution. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |