SALL2 polyclonal antibody View larger

SALL2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SALL2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SALL2 polyclonal antibody

Brand: Abnova
Reference: PAB30368
Product name: SALL2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human SALL2.
Isotype: IgG
Gene id: 6297
Gene name: SALL2
Gene alias: FLJ10414|FLJ55746|HSAL2|KIAA0360|ZNF795|p150(Sal2)
Gene description: sal-like 2 (Drosophila)
Immunogen: Recombinant protein corresponding to human SALL2.
Immunogen sequence/protein sequence: FLAHQNACSTDPPVMVIIGGQENPNNSSASSEPRPEGHNNPQVMDTEHSNPPDSGSSVPTDPTWGPERRGEESSGHFLVAATGTAAGGGGGLILASPKLGATPLPPESTPA
Protein accession: Q9Y467
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30368-48-52-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum with SALL2 polyclonal antibody (Cat # PAB30368) shows strong nuclear positivity in Purkinje cells, cells in molecular layer and cells in granular layer at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SALL2 polyclonal antibody now

Add to cart