CTSH polyclonal antibody View larger

CTSH polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CTSH polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about CTSH polyclonal antibody

Brand: Abnova
Reference: PAB30344
Product name: CTSH polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human CTSH.
Isotype: IgG
Gene id: 1512
Gene name: CTSH
Gene alias: ACC-4|ACC-5|CPSB|DKFZp686B24257|MGC1519|minichain
Gene description: cathepsin H
Immunogen: Recombinant protein corresponding to human CTSH.
Immunogen sequence/protein sequence: LPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFL
Protein accession: P09668
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30344-48-2-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with CTSH polyclonal antibody (Cat # PAB30344) shows strong cytoplasmic positivity, with a granular pattern, in cells in tubules at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy CTSH polyclonal antibody now

Add to cart