NFKBIE polyclonal antibody View larger

NFKBIE polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NFKBIE polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about NFKBIE polyclonal antibody

Brand: Abnova
Reference: PAB30327
Product name: NFKBIE polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human NFKBIE.
Isotype: IgG
Gene id: 4794
Gene name: NFKBIE
Gene alias: IKBE
Gene description: nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon
Immunogen: Recombinant protein corresponding to human NFKBIE.
Immunogen sequence/protein sequence: PEPGRGTSHSLDLQLQNWQGLACLHIATLQKNQPLMELLLRNGADIDVQEGTSGKTALHLAVETQERGLVQFLLQAGAQVDARMLNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEESLVLLPFDDLKI
Protein accession: O00221
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30327-48-33-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human prostate with NFKBIE polyclonal antibody (Cat # PAB30327) shows cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy NFKBIE polyclonal antibody now

Add to cart