NCR2 polyclonal antibody View larger

NCR2 polyclonal antibody

New product

375,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NCR2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesRabbit
ApplicationsIHC-P

More info about NCR2 polyclonal antibody

Reference: PAB30306
Product name: NCR2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human NCR2.
Isotype: IgG
Gene id: 9436
Gene name: NCR2
Gene alias: CD336|LY95|NK-p44|NKP44|dJ149M18.1
Gene description: natural cytotoxicity triggering receptor 2
Immunogen: Recombinant protein corresponding to amino acids 35-104 of human NCR2.
Immunogen sequence/protein sequence: TLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDS
Protein accession: O95944
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000 - 1:2500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Shipping condition: Dry Ice

Reviews

Buy NCR2 polyclonal antibody now

Add to cart