IL2RB polyclonal antibody View larger

IL2RB polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL2RB polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about IL2RB polyclonal antibody

Brand: Abnova
Reference: PAB30302
Product name: IL2RB polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human IL2RB.
Isotype: IgG
Gene id: 3560
Gene name: IL2RB
Gene alias: CD122|P70-75
Gene description: interleukin 2 receptor, beta
Immunogen: Recombinant protein corresponding to amino acids 66-122 of human IL2RB.
Immunogen sequence/protein sequence: DRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQ
Protein accession: P14784
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000 - 1:2500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30302-48-10-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with IL2RB polyclonal antibody (Cat # PAB30302) shows strong cytoplasmic positivity in non-germinal center cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy IL2RB polyclonal antibody now

Add to cart