ENPP1 polyclonal antibody View larger

ENPP1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ENPP1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about ENPP1 polyclonal antibody

Brand: Abnova
Reference: PAB30301
Product name: ENPP1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human ENPP1.
Isotype: IgG
Gene id: 5167
Gene name: ENPP1
Gene alias: M6S1|NPP1|NPPS|PC-1|PCA1|PDNP1
Gene description: ectonucleotide pyrophosphatase/phosphodiesterase 1
Immunogen: Recombinant protein corresponding to amino acids 96-149 of human ENPP1.
Immunogen sequence/protein sequence: GLKPSCAKEVKSCKGRCFERTFGNCRCDAACVELGNCCLDYQETCIEPEHIWTC
Protein accession: P22413
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30301-48-41-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human placenta with ENPP1 polyclonal antibody (Cat # PAB30301) shows cytoplasmic positivity in stromal cells.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy ENPP1 polyclonal antibody now

Add to cart