Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB30300 |
Product name: | F11R polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human F11R. |
Isotype: | IgG |
Gene id: | 50848 |
Gene name: | F11R |
Gene alias: | CD321|JAM|JAM-1|JAM-A|JAM1|JAMA|JCAM|KAT|PAM-1 |
Gene description: | F11 receptor |
Immunogen: | Recombinant protein corresponding to amino acids 31-101 of human F11R. |
Immunogen sequence/protein sequence: | VHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTR |
Protein accession: | Q9Y624 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human esophagus with F11R polyclonal antibody (Cat # PAB30300) shows membranous positivity in squamous epithelial cells. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |