ITGA2 polyclonal antibody View larger

ITGA2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ITGA2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ITGA2 polyclonal antibody

Brand: Abnova
Reference: PAB30299
Product name: ITGA2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human ITGA2.
Isotype: IgG
Gene id: 3673
Gene name: ITGA2
Gene alias: BR|CD49B|GPIa|VLA-2|VLAA2
Gene description: integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
Immunogen: Recombinant protein corresponding to amino acids 1032-1126 of human ITGA2.
Immunogen sequence/protein sequence: SSSVSFKSENFRHTKELNCRTASCSNVTCWLKDVHMKGEYFVNVTTRIWNGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDE
Protein accession: P17301
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30299-48-38-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human pancreas with ITGA2 polyclonal antibody (Cat # PAB30299) shows strong cytoplasmic positivity in exocrine glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ITGA2 polyclonal antibody now

Add to cart