CR2 polyclonal antibody View larger

CR2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CR2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about CR2 polyclonal antibody

Brand: Abnova
Reference: PAB30297
Product name: CR2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human CR2.
Isotype: IgG
Gene id: 1380
Gene name: CR2
Gene alias: C3DR|CD21|SLEB9
Gene description: complement component (3d/Epstein Barr virus) receptor 2
Immunogen: Recombinant protein corresponding to amino acids 46-129 of human CR2.
Immunogen sequence/protein sequence: VIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKS
Protein accession: P20023
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:250 - 1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30297-48-5-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human tonsil with CR2 polyclonal antibody (Cat # PAB30297) shows strong cytoplasmic positivity in germinal center cells.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CR2 polyclonal antibody now

Add to cart