LY9 polyclonal antibody View larger

LY9 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LY9 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about LY9 polyclonal antibody

Brand: Abnova
Reference: PAB30276
Product name: LY9 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human LY9.
Isotype: IgG
Gene id: 4063
Gene name: LY9
Gene alias: CD229|SLAMF3|hly9|mLY9
Gene description: lymphocyte antigen 9
Immunogen: Recombinant protein corresponding to amino acids 477-561 of human LY9.
Immunogen sequence/protein sequence: KRKGRCSVPAFCSSQAEAPADTPEPTAGHTLYSVLSQGYEKLDTPLRPARQQPTPTSDSSSDSNLTTEEDEDRPEVHKPISGRYE
Protein accession: Q9HBG7
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000 - 1:2500)
Western Blot (1:1000 - 1:2500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30276-48-2-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with LY9 polyclonal antibody (Cat # PAB30276) shows strong membranous positivity in cells in tubules.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy LY9 polyclonal antibody now

Add to cart