SIRPB1 polyclonal antibody View larger

SIRPB1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SIRPB1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SIRPB1 polyclonal antibody

Brand: Abnova
Reference: PAB30263
Product name: SIRPB1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human SIRPB1.
Isotype: IgG
Gene id: 10326
Gene name: SIRPB1
Gene alias: CD172b|DKFZp686A05192|FLJ26614|SIRP-BETA-1
Gene description: signal-regulatory protein beta 1
Immunogen: Recombinant protein corresponding to amino acids 340-371 of human SIRPB1.
Immunogen sequence/protein sequence: VSKSYALEISAHQKEHGSDITHEPALAPTAPL
Protein accession: O00241
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30263-48-3-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human heart muscle with SIRPB1 polyclonal antibody (Cat # PAB30263) shows strong cytoplasmic positivity in myocytes.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SIRPB1 polyclonal antibody now

Add to cart