Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SOX11 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about SOX11 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB30260 |
| Product name: | SOX11 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant human SOX11. |
| Isotype: | IgG |
| Gene id: | 6664 |
| Gene name: | SOX11 |
| Gene alias: | - |
| Gene description: | SRY (sex determining region Y)-box 11 |
| Immunogen: | Recombinant protein corresponding to amino acids of human SOX11. |
| Immunogen sequence/protein sequence: | FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK |
| Protein accession: | P35716 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lateral ventricle with SOX11 polyclonal antibody (Cat # PAB30260) shows nuclear positivity in glial cells at 1:200 - 1:500 dilution. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |