GNPDA1 polyclonal antibody View larger

GNPDA1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GNPDA1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,IHC-P

More info about GNPDA1 polyclonal antibody

Brand: Abnova
Reference: PAB30259
Product name: GNPDA1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human GNPDA1.
Isotype: IgG
Gene id: 10007
Gene name: GNPDA1
Gene alias: GNPDA|GNPI|GPI|HLN|KIAA0060
Gene description: glucosamine-6-phosphate deaminase 1
Immunogen: Recombinant protein corresponding to amino acids of human GNPDA1.
Immunogen sequence/protein sequence: EHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLGCYKKLIEYYKNGDLSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQAECDAFEEKIKAA
Protein accession: P46926
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30259-48-12-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with GNPDA1 polyclonal antibody (Cat # PAB30259) shows moderate cytoplasmic positivity in germ cells at 1:200 - 1:500 dilution.
Applications: WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy GNPDA1 polyclonal antibody now

Add to cart