ESR1 polyclonal antibody View larger

ESR1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ESR1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,IHC-P

More info about ESR1 polyclonal antibody

Brand: Abnova
Reference: PAB30256
Product name: ESR1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human ESR1.
Isotype: IgG
Gene id: 2099
Gene name: ESR1
Gene alias: DKFZp686N23123|ER|ESR|ESRA|Era|NR3A1
Gene description: estrogen receptor 1
Immunogen: Recombinant protein corresponding to amino acids of human ESR1.
Immunogen sequence/protein sequence: FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTID
Protein accession: P03372
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30256-48-143-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human uterus with ESR1 polyclonal antibody (Cat # PAB30256) shows strong nuclear positivity in both stroma and glandular cells at 1:200 - 1:500 dilution.
Applications: WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy ESR1 polyclonal antibody now

Add to cart