ACE2 polyclonal antibody View larger

ACE2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACE2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,IHC-P

More info about ACE2 polyclonal antibody

Brand: Abnova
Reference: PAB30253
Product name: ACE2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant human ACE2.
Isotype: IgG
Gene id: 59272
Gene name: ACE2
Gene alias: ACEH|DKFZp434A014
Gene description: angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
Immunogen: Recombinant protein corresponding to amino acids of human ACE2.
Immunogen sequence/protein sequence: MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED
Protein accession: Q9BYF1
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30253-48-2-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with ACE2 polyclonal antibody (Cat # PAB30253) shows strong cytoplasmic positivity in renal tubules at 1:200 - 1:500 dilution.
Applications: WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy ACE2 polyclonal antibody now

Add to cart